PRKAB1 Antikörper (N-Term)
-
- Target Alle PRKAB1 Antikörper anzeigen
- PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRKAB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKAB1 antibody was raised against the N terminal of PRKAB1
- Aufreinigung
- Affinity purified
- Immunogen
- PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW
- Top Product
- Discover our top product PRKAB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKAB1 Blocking Peptide, catalog no. 33R-4439, is also available for use as a blocking control in assays to test for specificity of this PRKAB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))
- Andere Bezeichnung
- PRKAB1 (PRKAB1 Produkte)
- Synonyme
- AMPK antikoerper, HAMPKb antikoerper, 1300015D22Rik antikoerper, AU021155 antikoerper, E430008F22 antikoerper, MGC82489 antikoerper, prkab1 antikoerper, wu:fk93d05 antikoerper, wu:fw87e09 antikoerper, zgc:56652 antikoerper, zgc:76975 antikoerper, zgc:92228 antikoerper, protein kinase AMP-activated non-catalytic subunit beta 1 antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit S homeolog antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit, b antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit, a antikoerper, PRKAB1 antikoerper, Prkab1 antikoerper, prkab1.S antikoerper, prkab1 antikoerper, prkab1b antikoerper, prkab1a antikoerper
- Hintergrund
- The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
- Molekulargewicht
- 30 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Warburg Effekt
-