CAB39 Antikörper (Middle Region)
-
- Target Alle CAB39 Antikörper anzeigen
- CAB39 (Calcium Binding Protein 39 (CAB39))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CAB39 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CAB39 antibody was raised against the middle region of CAB39
- Aufreinigung
- Affinity purified
- Immunogen
- CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP
- Top Product
- Discover our top product CAB39 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CAB39 Blocking Peptide, catalog no. 33R-4688, is also available for use as a blocking control in assays to test for specificity of this CAB39 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAB39 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAB39 (Calcium Binding Protein 39 (CAB39))
- Andere Bezeichnung
- CAB39 (CAB39 Produkte)
- Synonyme
- CG4083 antikoerper, Dmel\\CG4083 antikoerper, Dmo25 antikoerper, dMo25 antikoerper, l(3)00274 antikoerper, mo25 antikoerper, fc06a03 antikoerper, zgc:86716 antikoerper, wu:fc06a03 antikoerper, MGC78903 antikoerper, CAB39 antikoerper, MO25 antikoerper, AA408805 antikoerper, AA960512 antikoerper, C78372 antikoerper, MO25alpha antikoerper, CG4083 gene product from transcript CG4083-RA antikoerper, calcium binding protein 39 antikoerper, calcium binding protein 39 L homeolog antikoerper, Cab39 protein antikoerper, Mo25 antikoerper, cab39 antikoerper, cab39.L antikoerper, CAB39 antikoerper, Bm1_33380 antikoerper, Cab39 antikoerper
- Hintergrund
- Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- AMPK Signaling
-