TBCCD1 Antikörper (N-Term)

Produktnummer ABIN632270

Produktdetails anti-TBCCD1 Antikörper

Target: TBCCD1 (TBCC Domain Containing 1 (TBCCD1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBCCD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TBCCD1 antibody was raised against the N terminal of TBCCD1

Aufreinigung: Affinity purified

Immunogen: TBCCD1 antibody was raised using the N terminal of TBCCD1 corresponding to a region with amino acids WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBCCD1 Blocking Peptide, catalog no. 33R-9990, is also available for use as a blocking control in assays to test for specificity of this TBCCD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCCD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBCCD1

Target: TBCCD1 (TBCC Domain Containing 1 (TBCCD1))

Andere Bezeichnung: TBCCD1 (TBCCD1 Produkte)

Synonyme: 5730478M09Rik antikoerper, AU015083 antikoerper, BB165076 antikoerper, Crygs antikoerper, si:ch211-194d6.5 antikoerper, zgc:162789 antikoerper, TBCC domain containing 1 antikoerper, TBCC domain containing 1 L homeolog antikoerper, TBCCD1 antikoerper, Tbccd1 antikoerper, tbccd1.L antikoerper, tbccd1 antikoerper

Hintergrund: The function of TBCCD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 63 kDa (MW of target protein)