RGS5 Antikörper (Middle Region)
-
- Target Alle RGS5 Antikörper anzeigen
- RGS5 (Regulator of G-Protein Signaling 5 (RGS5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RGS5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RGS5 antibody was raised against the middle region of RGS5
- Aufreinigung
- Affinity purified
- Immunogen
- RGS5 antibody was raised using the middle region of RGS5 corresponding to a region with amino acids PGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI
- Top Product
- Discover our top product RGS5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RGS5 Blocking Peptide, catalog no. 33R-7114, is also available for use as a blocking control in assays to test for specificity of this RGS5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RGS5 (Regulator of G-Protein Signaling 5 (RGS5))
- Andere Bezeichnung
- RGS5 (RGS5 Produkte)
- Synonyme
- MST092 antikoerper, MST106 antikoerper, MST129 antikoerper, MSTP032 antikoerper, MSTP092 antikoerper, MSTP106 antikoerper, MSTP129 antikoerper, RGS5 antikoerper, 1110070A02Rik antikoerper, fj30h05 antikoerper, rgs5 antikoerper, wu:fj30h05 antikoerper, zgc:64006 antikoerper, xrgs5 antikoerper, MGC147439 antikoerper, zgc:110206 antikoerper, regulator of G protein signaling 5 antikoerper, regulator of G-protein signaling 5 antikoerper, regulator of G protein signaling 5a antikoerper, regulator of G-protein signaling 5 L homeolog antikoerper, regulator of G protein signaling 5b antikoerper, RGS5 antikoerper, Rgs5 antikoerper, rgs5a antikoerper, rgs5 antikoerper, rgs5.L antikoerper, rgs5b antikoerper
- Hintergrund
- The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-