PRMT3 Antikörper (Middle Region)
-
- Target Alle PRMT3 Antikörper anzeigen
- PRMT3 (Protein Arginine Methyltransferase 3 (PRMT3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRMT3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRMT3 antibody was raised against the middle region of PRMT3
- Aufreinigung
- Affinity purified
- Immunogen
- PRMT3 antibody was raised using the middle region of PRMT3 corresponding to a region with amino acids LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK
- Top Product
- Discover our top product PRMT3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRMT3 Blocking Peptide, catalog no. 33R-4896, is also available for use as a blocking control in assays to test for specificity of this PRMT3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRMT3 (Protein Arginine Methyltransferase 3 (PRMT3))
- Andere Bezeichnung
- PRMT3 (PRMT3 Produkte)
- Synonyme
- HRMT1L3 antikoerper, 2010005E20Rik antikoerper, 2410018A17Rik antikoerper, AL033309 antikoerper, Hrmt1l3 antikoerper, PRMT3 antikoerper, hrmt1l3 antikoerper, zgc:112498 antikoerper, ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 3 antikoerper, ATPRMT3 antikoerper, protein arginine methyltransferase 3 antikoerper, protein arginine methyltransferase 3 antikoerper, protein arginine N-methyltransferase 3 antikoerper, protein arginine methyltransferase 3 S homeolog antikoerper, PRMT3 antikoerper, Prmt3 antikoerper, prmt3 antikoerper, prmt3.S antikoerper
- Hintergrund
- Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins.
- Molekulargewicht
- 60 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-