PPME1 Antikörper (N-Term)

Produktnummer ABIN632281

Produktdetails anti-PPME1 Antikörper

Target: PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPME1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PPME1 antibody was raised against the N terminal of PPME1

Aufreinigung: Affinity purified

Immunogen: PPME1 antibody was raised using the N terminal of PPME1 corresponding to a region with amino acids MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPME1 Blocking Peptide, catalog no. 33R-6394, is also available for use as a blocking control in assays to test for specificity of this PPME1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPME1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPME1

Target: PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))

Andere Bezeichnung: PPME1 (PPME1 Produkte)

Synonyme: PME-1 antikoerper, 1110069N17Rik antikoerper, 2700017M01Rik antikoerper, Pme1 antikoerper, fk72d03 antikoerper, zgc:56239 antikoerper, wu:fk72d03 antikoerper, RGD1309683 antikoerper, PME1MGC133824 antikoerper, F28M11.4 antikoerper, DDBDRAFT_0204584 antikoerper, DDBDRAFT_0305014 antikoerper, DDB_0204584 antikoerper, DDB_0305014 antikoerper, PME1 antikoerper, CaO19.1459 antikoerper, protein phosphatase methylesterase 1 antikoerper, protein phosphatase methylesterase 1 S homeolog antikoerper, esterase/lipase/thioesterase family protein antikoerper, carboxylesterase-mitochondrial 37S ribosomal protein YmS2 antikoerper, PPME1 antikoerper, Ppme1 antikoerper, ppme1 antikoerper, ppme1.S antikoerper, AT4G10050 antikoerper, PPE1 antikoerper

Hintergrund: Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process