C1orf92 Antikörper (Middle Region)
-
- Target Alle C1orf92 (LRRC71) Produkte
- C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C1orf92 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C1 ORF92 antibody was raised against the middle region of C1 rf92
- Aufreinigung
- Affinity purified
- Immunogen
- C1 ORF92 antibody was raised using the middle region of C1 rf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C1ORF92 Blocking Peptide, catalog no. 33R-9468, is also available for use as a blocking control in assays to test for specificity of this C1ORF92 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF92 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))
- Andere Bezeichnung
- C1ORF92 (LRRC71 Produkte)
- Synonyme
- C1orf92 antikoerper, RP11-356J7.1 antikoerper, 4933430H15Rik antikoerper, cilia and flagella associated protein 46 antikoerper, leucine rich repeat containing 71 antikoerper, cfap46 antikoerper, LRRC71 antikoerper, Lrrc71 antikoerper
- Hintergrund
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 39 kDa (MW of target protein)
-