SEC14L4 Antikörper

Produktnummer ABIN632289

Produktdetails anti-SEC14L4 Antikörper

Target: SEC14L4 (SEC14-Like 4 (SEC14L4))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEC14L4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SEC14 L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SEC14L4 Blocking Peptide, catalog no. 33R-6510, is also available for use as a blocking control in assays to test for specificity of this SEC14L4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC10 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEC14L4

Target: SEC14L4 (SEC14-Like 4 (SEC14L4))

Andere Bezeichnung: SEC14L4 (SEC14L4 Produkte)

Synonyme: TAP3 antikoerper, AI256582 antikoerper, AW536553 antikoerper, SPF antikoerper, TAP antikoerper, RGD1565810 antikoerper, SEC14 like lipid binding 4 antikoerper, SEC14-like protein 4 antikoerper, SEC14-like lipid binding 4 antikoerper, SEC14L4 antikoerper, LOC486353 antikoerper, Sec14l4 antikoerper

Hintergrund: SEC14L4 is a probable hydrophobic ligand-binding protein, may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.

Molekulargewicht: 47 kDa (MW of target protein)