SEC14L4 Antikörper
-
- Target Alle SEC14L4 Antikörper anzeigen
- SEC14L4 (SEC14-Like 4 (SEC14L4))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SEC14L4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SEC14 L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ
- Top Product
- Discover our top product SEC14L4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SEC14L4 Blocking Peptide, catalog no. 33R-6510, is also available for use as a blocking control in assays to test for specificity of this SEC14L4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC10 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEC14L4 (SEC14-Like 4 (SEC14L4))
- Andere Bezeichnung
- SEC14L4 (SEC14L4 Produkte)
- Hintergrund
- SEC14L4 is a probable hydrophobic ligand-binding protein, may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.
- Molekulargewicht
- 47 kDa (MW of target protein)
-