TRABD Antikörper (Middle Region)

Produktnummer ABIN632292

Produktdetails anti-TRABD Antikörper

Target: TRABD (TraB Domain Containing (TRABD))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRABD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRABD antibody was raised against the middle region of TRABD

Aufreinigung: Affinity purified

Immunogen: TRABD antibody was raised using the middle region of TRABD corresponding to a region with amino acids LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRABD Blocking Peptide, catalog no. 33R-4818, is also available for use as a blocking control in assays to test for specificity of this TRABD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRABD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRABD

Target: TRABD (TraB Domain Containing (TRABD))

Andere Bezeichnung: TRABD (TRABD Produkte)

Synonyme: TRABD antikoerper, LP6054 antikoerper, PP2447 antikoerper, fb66c10 antikoerper, wu:fb66c10 antikoerper, wu:fi04e11 antikoerper, zgc:66436 antikoerper, 5730502D15Rik antikoerper, AL023039 antikoerper, RGD1310875 antikoerper, TraB domain containing antikoerper, TraB domain containing L homeolog antikoerper, TRABD antikoerper, trabd antikoerper, trabd.L antikoerper, Trabd antikoerper

Hintergrund: The function of TRABD protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 42 kDa (MW of target protein)