TRABD Antikörper (Middle Region)
-
- Target Alle TRABD Produkte
- TRABD (TraB Domain Containing (TRABD))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Maus, Ratte, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRABD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRABD antibody was raised against the middle region of TRABD
- Aufreinigung
- Affinity purified
- Immunogen
- TRABD antibody was raised using the middle region of TRABD corresponding to a region with amino acids LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRABD Blocking Peptide, catalog no. 33R-4818, is also available for use as a blocking control in assays to test for specificity of this TRABD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRABD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRABD (TraB Domain Containing (TRABD))
- Andere Bezeichnung
- TRABD (TRABD Produkte)
- Synonyme
- TRABD antikoerper, LP6054 antikoerper, PP2447 antikoerper, fb66c10 antikoerper, wu:fb66c10 antikoerper, wu:fi04e11 antikoerper, zgc:66436 antikoerper, 5730502D15Rik antikoerper, AL023039 antikoerper, RGD1310875 antikoerper, TraB domain containing antikoerper, TraB domain containing L homeolog antikoerper, TRABD antikoerper, trabd antikoerper, trabd.L antikoerper, Trabd antikoerper
- Hintergrund
- The function of TRABD protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 42 kDa (MW of target protein)
-