Proline Rich 13 Antikörper (Middle Region)
-
- Target Alle Proline Rich 13 (PRR13) Antikörper anzeigen
- Proline Rich 13 (PRR13)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Proline Rich 13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRR13 antibody was raised against the middle region of PRR13
- Aufreinigung
- Affinity purified
- Immunogen
- PRR13 antibody was raised using the middle region of PRR13 corresponding to a region with amino acids PFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPP
- Top Product
- Discover our top product PRR13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRR13 Blocking Peptide, catalog no. 33R-7083, is also available for use as a blocking control in assays to test for specificity of this PRR13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Proline Rich 13 (PRR13)
- Andere Bezeichnung
- PRR13 (PRR13 Produkte)
- Synonyme
- MGC133876 antikoerper, TXR1 antikoerper, 1110020C13Rik antikoerper, 2010324E22Rik antikoerper, RGD1307129 antikoerper, proline rich 13 antikoerper, PRR13 antikoerper, Prr13 antikoerper
- Hintergrund
- PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.
- Molekulargewicht
- 15 kDa (MW of target protein)
-