SUN3 Antikörper (C-Term)

Produktnummer ABIN632305

Produktdetails anti-SUN3 Antikörper

Target: SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SUNC1 antibody was raised against the C terminal of SUNC1

Aufreinigung: Affinity purified

Immunogen: SUNC1 antibody was raised using the C terminal of SUNC1 corresponding to a region with amino acids IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SUNC1 Blocking Peptide, catalog no. 33R-4024, is also available for use as a blocking control in assays to test for specificity of this SUNC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUNC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUN3

Target: SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))

Andere Bezeichnung: SUNC1 (SUN3 Produkte)

Synonyme: SUNC1 antikoerper, D630047F21Rik antikoerper, Sunc1 antikoerper, Sad1 and UNC84 domain containing 3 antikoerper, SUN3 antikoerper, Sun3 antikoerper

Hintergrund: SUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.

Molekulargewicht: 40 kDa (MW of target protein)