LDHB Antikörper (C-Term)

Produktnummer ABIN632307

Produktdetails anti-LDHB Antikörper

Target: LDHB (Lactate Dehydrogenase B (LDHB))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LDHB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LDHB antibody was raised against the C terminal of LDHB

Aufreinigung: Affinity purified

Immunogen: LDHB antibody was raised using the C terminal of LDHB corresponding to a region with amino acids MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LDHB Blocking Peptide, catalog no. 33R-6625, is also available for use as a blocking control in assays to test for specificity of this LDHB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LDHB

Target: LDHB (Lactate Dehydrogenase B (LDHB))

Andere Bezeichnung: LDHB (LDHB Produkte)

Synonyme: LDH-B antikoerper, LDH-H antikoerper, LDHBD antikoerper, TRG-5 antikoerper, AI790582 antikoerper, H-Ldh antikoerper, Ldh-2 antikoerper, Ldh2 antikoerper, ldh-h antikoerper, ldh2 antikoerper, ldhb antikoerper, ldhba antikoerper, trg-5 antikoerper, LDHB antikoerper, LDH-B-A antikoerper, wu:fa16d07 antikoerper, wu:fa20c10 antikoerper, wu:fa96a08 antikoerper, LDH-B-B antikoerper, zgc:92882 antikoerper, lactate dehydrogenase B antikoerper, lactate dehydrogenase B S homeolog antikoerper, lactate dehydrogenase Ba antikoerper, lactate dehydrogenase Bb antikoerper, LDHB antikoerper, Ldhb antikoerper, ldhb.S antikoerper, ldhb antikoerper, ldhba antikoerper, ldhbb antikoerper

Hintergrund: LDHB belongs to the LDH/MDH superfamily, LDH family. Defects in LDHB are a cause of hereditary LDHB deficiency. LDHB may also have roles in progression of medulloblastoma.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Warburg Effekt