LCA5 Antikörper (N-Term)

Produktnummer ABIN632308

Produktdetails anti-LCA5 Antikörper

Target: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LCA5 antibody was raised against the N terminal of LCA5

Aufreinigung: Affinity purified

Immunogen: LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LCA5 Blocking Peptide, catalog no. 33R-3071, is also available for use as a blocking control in assays to test for specificity of this LCA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCA5

Target: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Andere Bezeichnung: LCA5 (LCA5 Produkte)

Synonyme: C6orf152 antikoerper, RGD1308555 antikoerper, 4930431B11Rik antikoerper, 5730406O13Rik antikoerper, AV274874 antikoerper, ORF64 antikoerper, LCA5, lebercilin antikoerper, Leber congenital amaurosis 5 antikoerper, Leber congenital amaurosis 5 (human) antikoerper, LCA5 antikoerper, LOC787523 antikoerper, Lca5 antikoerper

Hintergrund: LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Mutations in this gene cause Leber congenital amaurosis type V. Alternative splicing results in two transcript variants.

Molekulargewicht: 80 kDa (MW of target protein)