Cyclin J Antikörper (N-Term)

Produktnummer ABIN632310

Produktdetails anti-Cyclin J Antikörper

Target: Cyclin J (CCNJ)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cyclin J Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cyclin J antibody was raised against the N terminal of CCNJ

Aufreinigung: Affinity purified

Immunogen: Cyclin J antibody was raised using the N terminal of CCNJ corresponding to a region with amino acids FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cyclin J Blocking Peptide, catalog no. 33R-2996, is also available for use as a blocking control in assays to test for specificity of this Cyclin J antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNJ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cyclin J

Target: Cyclin J (CCNJ)

Andere Bezeichnung: Cyclin J (CCNJ Produkte)

Synonyme: bA690P14.1 antikoerper, CDI5 antikoerper, CG10308 antikoerper, Cdi5 antikoerper, Dmel\\CG10308 antikoerper, cdi5 antikoerper, cycJ antikoerper, cyclinJ antikoerper, D430039C20Rik antikoerper, MGC81420 antikoerper, ba690p14.1 antikoerper, cyclin J antikoerper, Cyclin J antikoerper, cyclin J S homeolog antikoerper, CCNJ antikoerper, CycJ antikoerper, Ccnj antikoerper, ccnj.S antikoerper, ccnj antikoerper, CpipJ_CPIJ015384 antikoerper, CpipJ_CPIJ016049 antikoerper

Hintergrund: Cyclin J may be involved in cell division and differentiation.

Molekulargewicht: 42 kDa (MW of target protein)