ASB7 Antikörper (Middle Region)
-
- Target Alle ASB7 Antikörper anzeigen
- ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ASB7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ASB7 antibody was raised against the middle region of ASB7
- Aufreinigung
- Affinity purified
- Immunogen
- ASB7 antibody was raised using the middle region of ASB7 corresponding to a region with amino acids QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC
- Top Product
- Discover our top product ASB7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ASB7 Blocking Peptide, catalog no. 33R-7760, is also available for use as a blocking control in assays to test for specificity of this ASB7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))
- Andere Bezeichnung
- ASB7 (ASB7 Produkte)
- Synonyme
- AI449039 antikoerper, Asb-7 antikoerper, D030055C23Rik antikoerper, asb7 antikoerper, zgc:77381 antikoerper, ASB-7 antikoerper, ankyrin repeat and SOCS box containing 7 antikoerper, ankyrin repeat and SOCS box-containing 7 antikoerper, ankyrin repeat and SOCS box containing 7 L homeolog antikoerper, ASB7 antikoerper, Asb7 antikoerper, asb7.L antikoerper, asb7 antikoerper
- Hintergrund
- The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described.
- Molekulargewicht
- 36 kDa (MW of target protein)
-