PPP1R11 Antikörper
-
- Target Alle PPP1R11 Antikörper anzeigen
- PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP1R11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN
- Top Product
- Discover our top product PPP1R11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPP1R11 Blocking Peptide, catalog no. 33R-5629, is also available for use as a blocking control in assays to test for specificity of this PPP1R11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))
- Andere Bezeichnung
- PPP1R11 (PPP1R11 Produkte)
- Hintergrund
- This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1.
- Molekulargewicht
- 14 kDa (MW of target protein)
-