UBLCP1 Antikörper (N-Term)

Produktnummer ABIN632320

Produktdetails anti-UBLCP1 Antikörper

Target: UBLCP1 (Ubiquitin-Like Domain Containing CTD Phosphatase 1 (UBLCP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBLCP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UBLCP1 antibody was raised against the N terminal of UBLCP1

Aufreinigung: Affinity purified

Immunogen: UBLCP1 antibody was raised using the N terminal of UBLCP1 corresponding to a region with amino acids MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBLCP1 Blocking Peptide, catalog no. 33R-5694, is also available for use as a blocking control in assays to test for specificity of this UBLCP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBLCP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBLCP1

Target: UBLCP1 (Ubiquitin-Like Domain Containing CTD Phosphatase 1 (UBLCP1))

Andere Bezeichnung: UBLCP1 (UBLCP1 Produkte)

Synonyme: UBLCP1 antikoerper, DKFZp459P2311 antikoerper, wu:fb33g09 antikoerper, zgc:86634 antikoerper, CPUB1 antikoerper, 4930527B16Rik antikoerper, 8430435I17Rik antikoerper, BC002236 antikoerper, RGD1310386 antikoerper, ubiquitin like domain containing CTD phosphatase 1 antikoerper, ubiquitin-like domain containing CTD phosphatase 1 antikoerper, ubiquitin like domain containing CTD phosphatase 1 S homeolog antikoerper, ublcp1 antikoerper, Ublcp1 antikoerper, UBLCP1 antikoerper, ublcp1.S antikoerper

Hintergrund: UBLCP1 may specifically dephosphorylate 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit.

Molekulargewicht: 37 kDa (MW of target protein)