PYCR2 Antikörper (Middle Region)
-
- Target Alle PYCR2 Antikörper anzeigen
- PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PYCR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PYCR2 antibody was raised against the middle region of PYCR2
- Aufreinigung
- Affinity purified
- Immunogen
- PYCR2 antibody was raised using the middle region of PYCR2 corresponding to a region with amino acids LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE
- Top Product
- Discover our top product PYCR2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PYCR2 Blocking Peptide, catalog no. 33R-4866, is also available for use as a blocking control in assays to test for specificity of this PYCR2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))
- Andere Bezeichnung
- PYCR2 (PYCR2 Produkte)
- Synonyme
- p5c antikoerper, p5cr antikoerper, pro3 antikoerper, pycr antikoerper, pig45 antikoerper, pp222 antikoerper, pycr2 antikoerper, arcl2b antikoerper, P5CR2 antikoerper, 1810018M05Rik antikoerper, P5cr2 antikoerper, pyrroline-5-carboxylate reductase 2 antikoerper, pyrroline-5-carboxylate reductase family, member 1 antikoerper, pyrroline-5-carboxylate reductase 1 antikoerper, pyrroline-5-carboxylate reductase family, member 2 antikoerper, pyrroline-5-carboxylate reductase 1b antikoerper, PYCR2 antikoerper, pycr1 antikoerper, PYCR1 antikoerper, Pycr2 antikoerper, pycr1b antikoerper
- Hintergrund
- PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.
- Molekulargewicht
- 34 kDa (MW of target protein)
-