USP36 Antikörper (N-Term)
-
- Target Alle USP36 Antikörper anzeigen
- USP36 (Ubiquitin Specific Peptidase 36 (USP36))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser USP36 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- USP36 antibody was raised against the N terminal of USP36
- Aufreinigung
- Affinity purified
- Immunogen
- USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
- Top Product
- Discover our top product USP36 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
USP36 Blocking Peptide, catalog no. 33R-8754, is also available for use as a blocking control in assays to test for specificity of this USP36 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP36 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- USP36 (Ubiquitin Specific Peptidase 36 (USP36))
- Andere Bezeichnung
- USP36 (USP36 Produkte)
- Hintergrund
- Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes such as the one encoded by USP36.
- Molekulargewicht
- 123 kDa (MW of target protein)
-