USP36 Antikörper (N-Term)

Produktnummer ABIN632340

Produktdetails anti-USP36 Antikörper

Target: USP36 (Ubiquitin Specific Peptidase 36 (USP36))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser USP36 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: USP36 antibody was raised against the N terminal of USP36

Aufreinigung: Affinity purified

Immunogen: USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

USP36 Blocking Peptide, catalog no. 33R-8754, is also available for use as a blocking control in assays to test for specificity of this USP36 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP36 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu USP36

Target: USP36 (Ubiquitin Specific Peptidase 36 (USP36))

Andere Bezeichnung: USP36 (USP36 Produkte)

Synonyme: wu:fd19b04 antikoerper, MGC81933 antikoerper, 2331 antikoerper, CG5505 antikoerper, Dmel\\CG5505 antikoerper, USP36 antikoerper, Usp36 antikoerper, anon-WO0118547.247 antikoerper, dUSP36 antikoerper, et antikoerper, l(3)02331 antikoerper, mule antikoerper, DUB1 antikoerper, 2700002L06Rik antikoerper, mKIAA1453 antikoerper, ubiquitin specific peptidase 36 antikoerper, ubiquitin specific peptidase 36 S homeolog antikoerper, scrawny antikoerper, usp36 antikoerper, usp36.S antikoerper, USP36 antikoerper, scny antikoerper, Usp36 antikoerper

Hintergrund: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes such as the one encoded by USP36.

Molekulargewicht: 123 kDa (MW of target protein)