Serotonin Receptor 2B Antikörper
-
- Target Alle Serotonin Receptor 2B (HTR2B) Antikörper anzeigen
- Serotonin Receptor 2B (HTR2B)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Serotonin Receptor 2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Serotonin receptor 2 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
- Top Product
- Discover our top product HTR2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Serotonin receptor 2B Blocking Peptide, catalog no. 33R-7748, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Serotonin Receptor 2B (HTR2B)
- Andere Bezeichnung
- Serotonin Receptor 2B (HTR2B Produkte)
- Synonyme
- 5-HT2B antikoerper, 5HT2B antikoerper, 5htr2b antikoerper, HTR2B antikoerper, 5ht2b antikoerper, zgc:194094 antikoerper, zgc:194119 antikoerper, AJ012488 antikoerper, AV377389 antikoerper, 5-HT(2B) antikoerper, 5-hydroxytryptamine receptor 2B antikoerper, 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled antikoerper, 5-hydroxytryptamine (serotonin) receptor 2B antikoerper, HTR2B antikoerper, htr2b antikoerper, Htr2b antikoerper
- Hintergrund
- Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognised. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets, central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.
- Molekulargewicht
- 54 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Carbohydrate Metabolic Process
-