EXOC6 Antikörper (N-Term)

Produktnummer ABIN632342

Produktdetails anti-EXOC6 Antikörper

Target: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EXOC6 antibody was raised against the N terminal of EXOC6

Aufreinigung: Affinity purified

Immunogen: EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOC6 Blocking Peptide, catalog no. 33R-6184, is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOC6

Target: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Andere Bezeichnung: EXOC6 (EXOC6 Produkte)

Synonyme: Sec15 antikoerper, Sec15l1 antikoerper, EXOC6A antikoerper, SEC15 antikoerper, SEC15L antikoerper, SEC15L1 antikoerper, SEC15L3 antikoerper, Sec15p antikoerper, 4833405E05Rik antikoerper, AW413330 antikoerper, C430002C19 antikoerper, hbd antikoerper, msec15 antikoerper, zgc:77548 antikoerper, SEC15A antikoerper, EXOC6 antikoerper, 3R41 antikoerper, CG7034 antikoerper, Dmel\\CG7034 antikoerper, dsec15 antikoerper, exocyst complex component 6 antikoerper, exocyst complex component 6B antikoerper, Exocyst complex component 6 antikoerper, Secretory 15 antikoerper, Exoc6 antikoerper, EXOC6 antikoerper, exoc6 antikoerper, LOC410084 antikoerper, EXOC6B antikoerper, CpipJ_CPIJ005438 antikoerper, Tsp_03288 antikoerper, sec-15 antikoerper, Sec15 antikoerper

Hintergrund: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molekulargewicht: 88 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis