EXOC6 Antikörper (N-Term)
-
- Target Alle EXOC6 Antikörper anzeigen
- EXOC6 (Exocyst Complex Component 6 (EXOC6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EXOC6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EXOC6 antibody was raised against the N terminal of EXOC6
- Aufreinigung
- Affinity purified
- Immunogen
- EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI
- Top Product
- Discover our top product EXOC6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXOC6 Blocking Peptide, catalog no. 33R-6184, is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOC6 (Exocyst Complex Component 6 (EXOC6))
- Andere Bezeichnung
- EXOC6 (EXOC6 Produkte)
- Hintergrund
- The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molekulargewicht
- 88 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis
-