MTHFS Antikörper
-
- Target Alle MTHFS Antikörper anzeigen
- MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTHFS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
- Top Product
- Discover our top product MTHFS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTHFS Blocking Peptide, catalog no. 33R-9306, is also available for use as a blocking control in assays to test for specificity of this MTHFS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))
- Andere Bezeichnung
- MTHFS (MTHFS Produkte)
- Synonyme
- MTHFS antikoerper, 1110034I12Rik antikoerper, 2310020H23Rik antikoerper, AI119695 antikoerper, HsT19268 antikoerper, 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) antikoerper, methenyltetrahydrofolate synthetase antikoerper, 5-formyltetrahydrofolate cyclo-ligase (predicted) antikoerper, 5-formyltetrahydrofolate cyclo-ligase antikoerper, 5, 10-methenyltetrahydrofolate synthetase antikoerper, MTHFS antikoerper, SPBC1703.08c antikoerper, ZMO0215 antikoerper, LBA1507 antikoerper, Rxyl_1321 antikoerper, MEMAR_RS07640 antikoerper, Mjls_4669 antikoerper, STROP_RS03755 antikoerper, Mext_0779 antikoerper, AMF_RS07350 antikoerper, CKC_02040 antikoerper, Mthfs antikoerper
- Hintergrund
- MTHFS contributes to tetrahydrofolate metabolism. It helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.
- Molekulargewicht
- 23 kDa (MW of target protein)
-