MED8 Antikörper (N-Term)
-
- Target Alle MED8 Antikörper anzeigen
- MED8 (Mediator Complex Subunit 8 (MED8))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MED8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MED8 antibody was raised against the N terminal of MED8
- Aufreinigung
- Affinity purified
- Immunogen
- MED8 antibody was raised using the N terminal of MED8 corresponding to a region with amino acids MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA
- Top Product
- Discover our top product MED8 Primärantikörper
-
anti-Mediator Complex Subunit 8 (MED8) antibody
MED8 Reaktivität: Human, Maus, Ratte WB, IF, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 1-59) antibodyMED8 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 1D3 unconjugated
anti-Mediator Complex Subunit 8 (MED8) (C-Term) antibodyMED8 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 1-195) antibodyMED8 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (Internal Region) antibodyMED8 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (Internal Region) antibodyMED8 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 95-122) antibodyMED8 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB20608 unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 1-59) antibodyMED8 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 1-59) antibodyMED8 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1E5 unconjugated
anti-Mediator Complex Subunit 8 (MED8) (N-Term) antibodyMED8 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Zebrafisch (Danio rerio), Fledermaus, Hamster, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MED8 Blocking Peptide, catalog no. 33R-6339, is also available for use as a blocking control in assays to test for specificity of this MED8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MED8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MED8 (Mediator Complex Subunit 8 (MED8))
- Andere Bezeichnung
- MED8 (MED8 Produkte)
- Synonyme
- ARC32 antikoerper, 2210021A15Rik antikoerper, AB041805 antikoerper, MNCb-2386 antikoerper, zgc:76877 antikoerper, med8-a antikoerper, mediator complex subunit 8 antikoerper, mediator complex subunit 8 L homeolog antikoerper, component of RNA polymerase II antikoerper, mediator complex subunit Med8 antikoerper, MED8 antikoerper, Med8 antikoerper, med8 antikoerper, med8.L antikoerper
- Hintergrund
- MED8 is a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. MED8 also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-
