FBXO16 Antikörper (C-Term)
-
- Target Alle FBXO16 Antikörper anzeigen
- FBXO16 (F-Box Protein 16 (FBXO16))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXO16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXO16 antibody was raised against the C terminal of FBXO16
- Aufreinigung
- Affinity purified
- Immunogen
- FBXO16 antibody was raised using the C terminal of FBXO16 corresponding to a region with amino acids SPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMET
- Top Product
- Discover our top product FBXO16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXO16 Blocking Peptide, catalog no. 33R-8681, is also available for use as a blocking control in assays to test for specificity of this FBXO16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO16 (F-Box Protein 16 (FBXO16))
- Andere Bezeichnung
- FBXO16 (FBXO16 Produkte)
- Synonyme
- si:ch211-89p3.1 antikoerper, zgc:112464 antikoerper, FBX16 antikoerper, 4932435C24Rik antikoerper, Fbx16 antikoerper, F-box protein 16 antikoerper, FBXO16 antikoerper, LOC100150082 antikoerper, fbxo16 antikoerper, Fbxo16 antikoerper
- Hintergrund
- FBXO16 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO16 belongs to the Fbx class.
- Molekulargewicht
- 34 kDa (MW of target protein)
-