KCTD21 Antikörper (N-Term)

Produktnummer ABIN632359

Produktdetails anti-KCTD21 Antikörper

Target: KCTD21 (Potassium Channel Tetramerisation Domain Containing 21 (KCTD21))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD21 antibody was raised against the N terminal of KCTD21

Aufreinigung: Affinity purified

Immunogen: KCTD21 antibody was raised using the N terminal of KCTD21 corresponding to a region with amino acids RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD21 Blocking Peptide, catalog no. 33R-7845, is also available for use as a blocking control in assays to test for specificity of this KCTD21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD21

Target: KCTD21 (Potassium Channel Tetramerisation Domain Containing 21 (KCTD21))

Andere Bezeichnung: KCTD21 (KCTD21 Produkte)

Synonyme: EG622320 antikoerper, KCASH2 antikoerper, RGD1559529 antikoerper, potassium channel tetramerization domain containing 21 antikoerper, potassium channel tetramerisation domain containing 21 antikoerper, KCTD21 antikoerper, Kctd21 antikoerper

Hintergrund: KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.

Molekulargewicht: 30 kDa (MW of target protein)