MPEG1 Antikörper (C-Term)

Produktnummer ABIN632360

Produktdetails anti-MPEG1 Antikörper

Target: MPEG1 (Macrophage Expressed Gene 1 (MPEG1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPEG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MPEG1 antibody was raised against MPEG1

Aufreinigung: Affinity purified

Immunogen: MPEG1 antibody was raised using a region of MPEG1 corresponding to amino acids: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPEG1 Blocking Peptide, is also available for use as a blocking control in assays to test for specificity of this MPEG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPEG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPEG1

Target: MPEG1 (Macrophage Expressed Gene 1 (MPEG1))

Andere Bezeichnung: MPEG1 (MPEG1 Produkte)

Synonyme: MPEG1 antikoerper, DKFZp469A1716 antikoerper, MPG1 antikoerper, MPS1 antikoerper, Mpg-1 antikoerper, fj09e08 antikoerper, wu:fb14d06 antikoerper, wu:fj09e08 antikoerper, zgc:66409 antikoerper, macrophage expressed 1 antikoerper, macrophage expressed 1, tandem duplicate 1 antikoerper, macrophage expressed gene 1 antikoerper, MPEG1 antikoerper, Mpeg1 antikoerper, mpeg1.1 antikoerper

Hintergrund: The function of MPEG1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 78 kDa (MW of target protein)