MPEG1 Antikörper (C-Term)
-
- Target Alle MPEG1 Produkte
- MPEG1 (Macrophage Expressed Gene 1 (MPEG1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPEG1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MPEG1 antibody was raised against MPEG1
- Aufreinigung
- Affinity purified
- Immunogen
- MPEG1 antibody was raised using a region of MPEG1 corresponding to amino acids: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MPEG1 Blocking Peptide, is also available for use as a blocking control in assays to test for specificity of this MPEG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPEG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPEG1 (Macrophage Expressed Gene 1 (MPEG1))
- Andere Bezeichnung
- MPEG1 (MPEG1 Produkte)
- Hintergrund
- The function of MPEG1 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 78 kDa (MW of target protein)
-