KLK-BL4 (C-Term) Antikörper

Produktnummer ABIN632362

Produktdetails

Target: KLK-BL4

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Spezifität: KLK-BL4 antibody was raised against the C terminal Of Klkbl4

Aufreinigung: Affinity purified

Immunogen: KLK-BL4 antibody was raised using the C terminal Of Klkbl4 corresponding to a region with amino acids EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLK-BL4 Blocking Peptide, catalog no. 33R-2284, is also available for use as a blocking control in assays to test for specificity of this KLK-BL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLKBL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: KLK-BL4

Hintergrund: Klkbl4 is a secreted protein. Klkbl4 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain.

Molekulargewicht: 44 kDa (MW of target protein)