SENP5 Antikörper (Middle Region)
-
- Target Alle SENP5 Antikörper anzeigen
- SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SENP5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SENP5 antibody was raised against the middle region of SENP5
- Aufreinigung
- Affinity purified
- Immunogen
- SENP5 antibody was raised using the middle region of SENP5 corresponding to a region with amino acids LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR
- Top Product
- Discover our top product SENP5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SENP5 Blocking Peptide, catalog no. 33R-5426, is also available for use as a blocking control in assays to test for specificity of this SENP5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))
- Andere Bezeichnung
- SENP5 (SENP5 Produkte)
- Hintergrund
- The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.
- Molekulargewicht
- 87 kDa (MW of target protein)
-