PFKFB4 Antikörper (N-Term)
-
- Target Alle PFKFB4 Antikörper anzeigen
- PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PFKFB4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PFKFB4 antibody was raised against the N terminal of PFKFB4
- Aufreinigung
- Affinity purified
- Immunogen
- PFKFB4 antibody was raised using the N terminal of PFKFB4 corresponding to a region with amino acids MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR
- Top Product
- Discover our top product PFKFB4 Primärantikörper
-
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (AA 266-296) antibody
PFKFB4 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB04059 unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) antibodyPFKFB4 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) antibodyPFKFB4 Reaktivität: Human WB, IF Wirt: Maus Monoclonal 1C8 unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (AA 274-303) antibodyPFKFB4 Reaktivität: Human, Maus WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (AA 266-368) antibodyPFKFB4 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (N-Term) antibodyPFKFB4 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Rind (Kuh), Schwein, Fledermaus, Hamster, Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (N-Term) antibodyPFKFB4 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Rind (Kuh) WB Wirt: Kaninchen Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (AA 266-296) antibodyPFKFB4 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PFKFB4 Blocking Peptide, catalog no. 33R-5758, is also available for use as a blocking control in assays to test for specificity of this PFKFB4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKFB4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))
- Andere Bezeichnung
- PFKFB4 (PFKFB4 Produkte)
- Synonyme
- MGC69186 antikoerper, MGC81068 antikoerper, PFKFB4 antikoerper, zgc:123288 antikoerper, C230090D14 antikoerper, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 antikoerper, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 S homeolog antikoerper, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4a antikoerper, pfkfb4 antikoerper, pfkfb4.S antikoerper, PFKFB4 antikoerper, pfkfb4a antikoerper, f264 antikoerper, Pfkfb4 antikoerper
- Hintergrund
- PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.
- Molekulargewicht
- 54 kDa (MW of target protein)
-
