HAUS7 Antikörper (Middle Region)
-
- Target Alle HAUS7 Antikörper anzeigen
- HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HAUS7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UCHL5 IP antibody was raised against the middle region of UCHL5 P
- Aufreinigung
- Affinity purified
- Immunogen
- UCHL5 IP antibody was raised using the middle region of UCHL5 P corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC
- Top Product
- Discover our top product HAUS7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UCHL5IP Blocking Peptide, catalog no. 33R-5125, is also available for use as a blocking control in assays to test for specificity of this UCHL5IP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL0 P antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))
- Andere Bezeichnung
- UCHL5IP (HAUS7 Produkte)
- Synonyme
- UCHL5IP antikoerper, UIP1 antikoerper, 1110020L19Rik antikoerper, Uchl5ip antikoerper, Uip1 antikoerper, RGD1562991 antikoerper, HAUS augmin like complex subunit 7 antikoerper, HAUS augmin-like complex, subunit 7 antikoerper, HAUS7 antikoerper, Haus7 antikoerper
- Hintergrund
- This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom
- Molekulargewicht
- 47 kDa (MW of target protein)
-