Desmin Antikörper (Middle Region)
-
- Target Alle Desmin (DES) Antikörper anzeigen
- Desmin (DES)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Desmin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Desmin antibody was raised against the middle region of DES
- Aufreinigung
- Affinity purified
- Immunogen
- Desmin antibody was raised using the middle region of DES corresponding to a region with amino acids MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT
- Top Product
- Discover our top product DES Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Desmin Blocking Peptide, catalog no. 33R-5684, is also available for use as a blocking control in assays to test for specificity of this Desmin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Desmin (DES)
- Andere Bezeichnung
- Desmin (DES Produkte)
- Synonyme
- DES antikoerper, des-b antikoerper, MGC80853 antikoerper, des antikoerper, csm1 antikoerper, csm2 antikoerper, desm antikoerper, cmd1i antikoerper, MGC75911 antikoerper, LOC100220724 antikoerper, desmin antikoerper, cb290 antikoerper, fb59a12 antikoerper, wu:fb59a12 antikoerper, zgc:109859 antikoerper, CSM1 antikoerper, CSM2 antikoerper, LGMD2R antikoerper, wu:fc11d08 antikoerper, zgc:154009 antikoerper, des-a antikoerper, MGC52614 antikoerper, desmin antikoerper, desmin, gene 1 L homeolog antikoerper, desmin, gene 1 antikoerper, desmin a antikoerper, desmin b antikoerper, desmin, gene 1 S homeolog antikoerper, desmin, gene 2 S homeolog antikoerper, DES antikoerper, des.1.L antikoerper, des.1 antikoerper, des antikoerper, desma antikoerper, Des antikoerper, desmb antikoerper, des.1.S antikoerper, des.2.S antikoerper
- Hintergrund
- DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.
- Molekulargewicht
- 53 kDa (MW of target protein)
-