Leiomodin 1 Antikörper

Produktnummer ABIN632381

Produktdetails anti-Leiomodin 1 Antikörper

Target: Leiomodin 1 (LMOD1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Leiomodin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Leiomodin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Leiomodin 1 Blocking Peptide, catalog no. 33R-8783, is also available for use as a blocking control in assays to test for specificity of this Leiomodin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMOD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Leiomodin 1

Target: Leiomodin 1 (LMOD1)

Andere Bezeichnung: Leiomodin 1 (LMOD1 Produkte)

Synonyme: 1D antikoerper, 64kD antikoerper, D1 antikoerper, SM-LMOD antikoerper, 9530015K06Rik antikoerper, SM-Lmod antikoerper, leiomodin 1 antikoerper, leiomodin 1 (smooth muscle) antikoerper, LMOD1 antikoerper, Lmod1 antikoerper

Hintergrund: The leiomodin 1 protein (LMOD1) has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.

Molekulargewicht: 67 kDa (MW of target protein)