HSD17B14 Antikörper
-
- Target Alle HSD17B14 Antikörper anzeigen
- HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HSD17B14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HSD17 B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP
- Top Product
- Discover our top product HSD17B14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HSD17B14 Blocking Peptide, catalog no. 33R-7670, is also available for use as a blocking control in assays to test for specificity of this HSD17B14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))
- Andere Bezeichnung
- HSD17B14 (HSD17B14 Produkte)
- Synonyme
- Dhrs10 antikoerper, retSDR3 antikoerper, 0610039E24Rik antikoerper, DHRS10 antikoerper, SDR47C1 antikoerper, SDR3 antikoerper, hydroxysteroid (17-beta) dehydrogenase 14 antikoerper, hydroxysteroid 17-beta dehydrogenase 14 antikoerper, Hsd17b14 antikoerper, HSD17B14 antikoerper
- Hintergrund
- 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.
- Molekulargewicht
- 28 kDa (MW of target protein)
-