VPS52 Antikörper
-
- Target Alle VPS52 Antikörper anzeigen
- VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VPS52 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- VPS52 antibody was raised using a synthetic peptide corresponding to a region with amino acids RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF
- Top Product
- Discover our top product VPS52 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VPS52 Blocking Peptide, catalog no. 33R-8283, is also available for use as a blocking control in assays to test for specificity of this VPS52 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS52 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))
- Andere Bezeichnung
- VPS52 (VPS52 Produkte)
- Synonyme
- ARE1 antikoerper, RP5-1033B10 antikoerper, SAC2 antikoerper, SACM2L antikoerper, dJ1033B10.5 antikoerper, Are1 antikoerper, Sacm2l antikoerper, D130068D18 antikoerper, D430041K17Rik antikoerper, fb94c11 antikoerper, sacm2l antikoerper, wu:fb94c11 antikoerper, VPS52, GARP complex subunit antikoerper, VPS52 GARP complex subunit antikoerper, vacuolar protein sorting 52 homolog (S. cerevisiae) antikoerper, VPS52 antikoerper, Vps52 antikoerper, vps52 antikoerper
- Hintergrund
- This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.
- Molekulargewicht
- 82 kDa (MW of target protein)
-