EXOC5 Antikörper (N-Term)

Produktnummer ABIN632393

Produktdetails anti-EXOC5 Antikörper

Target: EXOC5 (Exocyst Complex Component 5 (EXOC5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EXOC5 antibody was raised against the N terminal of EXOC5

Aufreinigung: Affinity purified

Immunogen: EXOC5 antibody was raised using the N terminal of EXOC5 corresponding to a region with amino acids ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOC5 Blocking Peptide, catalog no. 33R-1562, is also available for use as a blocking control in assays to test for specificity of this EXOC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOC5

Target: EXOC5 (Exocyst Complex Component 5 (EXOC5))

Andere Bezeichnung: EXOC5 (EXOC5 Produkte)

Synonyme: CG6159 antikoerper, Dmel\\CG6159 antikoerper, P71 antikoerper, Sec10 antikoerper, Sec10p antikoerper, dSec10 antikoerper, dsec10 antikoerper, SEC10L1 antikoerper, MGC80624 antikoerper, sec10l1 antikoerper, zgc:175220 antikoerper, HSEC10 antikoerper, PRO1912 antikoerper, SEC10 antikoerper, SEC10P antikoerper, AI447711 antikoerper, AI448003 antikoerper, Gm76 antikoerper, Sec10l1 antikoerper, exocyst complex component sec10 antikoerper, Secretory 10 antikoerper, exocyst complex component 5 antikoerper, exocyst complex component 5 L homeolog antikoerper, exocyst complex component sec10 antikoerper, Exocyst complex component 5 antikoerper, Sec10 antikoerper, EXOC5 antikoerper, exoc5.L antikoerper, exoc5 antikoerper, CpipJ_CPIJ009626 antikoerper, Tsp_08508 antikoerper, Tsp_12387 antikoerper, Exoc5 antikoerper, SEC10 antikoerper, sec-10 antikoerper

Hintergrund: The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.

Molekulargewicht: 82 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis