AP3S1 Antikörper (N-Term)
-
- Target Alle AP3S1 Antikörper anzeigen
- AP3S1 (Adaptor-Related Protein Complex 3, sigma 1 Subunit (AP3S1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AP3S1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AP3 S1 antibody was raised against the N terminal of AP3 1
- Aufreinigung
- Affinity purified
- Immunogen
- AP3 S1 antibody was raised using the N terminal of AP3 1 corresponding to a region with amino acids IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE
- Top Product
- Discover our top product AP3S1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AP3S1 Blocking Peptide, catalog no. 33R-4012, is also available for use as a blocking control in assays to test for specificity of this AP3S1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AP3S1 (Adaptor-Related Protein Complex 3, sigma 1 Subunit (AP3S1))
- Andere Bezeichnung
- AP3S1 (AP3S1 Produkte)
- Hintergrund
- AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.
- Molekulargewicht
- 22 kDa (MW of target protein)
-