AP3S1 Antikörper (N-Term)

Produktnummer ABIN632399

Produktdetails anti-AP3S1 Antikörper

Target: AP3S1 (Adaptor-Related Protein Complex 3, sigma 1 Subunit (AP3S1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AP3S1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AP3 S1 antibody was raised against the N terminal of AP3 1

Aufreinigung: Affinity purified

Immunogen: AP3 S1 antibody was raised using the N terminal of AP3 1 corresponding to a region with amino acids IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AP3S1 Blocking Peptide, catalog no. 33R-4012, is also available for use as a blocking control in assays to test for specificity of this AP3S1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AP3S1

Target: AP3S1 (Adaptor-Related Protein Complex 3, sigma 1 Subunit (AP3S1))

Andere Bezeichnung: AP3S1 (AP3S1 Produkte)

Synonyme: CLAPS3 antikoerper, Sigma3A antikoerper, [s]3A antikoerper, adaptor related protein complex 3 sigma 1 subunit antikoerper, adaptor-related protein complex 3, sigma 1 subunit antikoerper, adaptor related protein complex 3 sigma 1 subunit S homeolog antikoerper, AP3S1 antikoerper, Ap3s1 antikoerper, ap3s1.S antikoerper

Hintergrund: AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Molekulargewicht: 22 kDa (MW of target protein)