ICA1 Antikörper (C-Term)
-
- Target Alle ICA1 Antikörper anzeigen
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ICA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ICA1 antibody was raised against the C terminal of ICA1
- Aufreinigung
- Affinity purified
- Immunogen
- ICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA
- Top Product
- Discover our top product ICA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ICA1 Blocking Peptide, catalog no. 33R-6795, is also available for use as a blocking control in assays to test for specificity of this ICA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
- Andere Bezeichnung
- ICA1 (ICA1 Produkte)
- Hintergrund
- ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome.
- Molekulargewicht
- 53 kDa (MW of target protein)
-