SCFD1 Antikörper (N-Term)

Produktnummer ABIN632406

Produktdetails anti-SCFD1 Antikörper

Target: SCFD1 (Sec1 Family Domain Containing 1 (SCFD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCFD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SCFD1 antibody was raised against the N terminal of SCFD1

Aufreinigung: Affinity purified

Immunogen: SCFD1 antibody was raised using the N terminal of SCFD1 corresponding to a region with amino acids SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCFD1 Blocking Peptide, catalog no. 33R-8323, is also available for use as a blocking control in assays to test for specificity of this SCFD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCFD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCFD1

Target: SCFD1 (Sec1 Family Domain Containing 1 (SCFD1))

Andere Bezeichnung: SCFD1 (SCFD1 Produkte)

Synonyme: DDBDRAFT_0188070 antikoerper, DDBDRAFT_0234142 antikoerper, DDB_0188070 antikoerper, DDB_0234142 antikoerper, C14orf163 antikoerper, RA410 antikoerper, SLY1 antikoerper, SLY1P antikoerper, STXBP1L2 antikoerper, 3110021P21Rik antikoerper, Sly1 antikoerper, rSly1 antikoerper, sec1 family domain containing 1 antikoerper, vesicle transport-related protein antikoerper, Sec1-like family protein antikoerper, sec1 family domain-containing protein 1 antikoerper, sec1 family domain containing 1 L homeolog antikoerper, Sec1 family domain containing 1 antikoerper, SCFD1 antikoerper, PVX_111025 antikoerper, scfd1 antikoerper, LOC100639066 antikoerper, scfd1.L antikoerper, Scfd1 antikoerper

Hintergrund: The function of SCFD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 65 kDa (MW of target protein)