TMED8 Antikörper (Middle Region)

Produktnummer ABIN632407

Produktdetails anti-TMED8 Antikörper

Target: TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMED8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMED8 antibody was raised against the middle region of TMED8

Aufreinigung: Affinity purified

Immunogen: TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMED8 Blocking Peptide, catalog no. 33R-2466, is also available for use as a blocking control in assays to test for specificity of this TMED8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMED8

Target: TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))

Andere Bezeichnung: TMED8 (TMED8 Produkte)

Synonyme: 6430595O10Rik antikoerper, AI447224 antikoerper, Gm1184 antikoerper, Mem1 antikoerper, FAM15B antikoerper, zgc:112014 antikoerper, transmembrane p24 trafficking protein 8 antikoerper, transmembrane p24 trafficking protein family member 8 antikoerper, Tmed8 antikoerper, TMED8 antikoerper, tmed8 antikoerper

Hintergrund: The function of TMED8 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 36 kDa (MW of target protein)