SH3GL1 Antikörper (N-Term)

Produktnummer ABIN632409

Produktdetails anti-SH3GL1 Antikörper

Target: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3GL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SH3 GL1 antibody was raised against the N terminal of SH3 L1

Aufreinigung: Affinity purified

Immunogen: SH3 GL1 antibody was raised using the N terminal of SH3 L1 corresponding to a region with amino acids LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3GL1 Blocking Peptide, catalog no. 33R-5248, is also available for use as a blocking control in assays to test for specificity of this SH3GL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3GL1

Target: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Andere Bezeichnung: SH3GL1 (SH3GL1 Produkte)

Synonyme: CNSA1 antikoerper, EEN antikoerper, SH3D2B antikoerper, SH3P8 antikoerper, C77078 antikoerper, Sh3d2b antikoerper, cb831 antikoerper, sh3gl1 antikoerper, MGC78966 antikoerper, MGC130739 antikoerper, sh3gl1b antikoerper, wu:fd12b05 antikoerper, wu:fy33c10 antikoerper, zgc:56637 antikoerper, SH3 domain containing GRB2 like 1, endophilin A2 antikoerper, SH3-domain GRB2-like 1 antikoerper, SH3-domain GRB2-like 1b antikoerper, SH3-domain GRB2-like 1 L homeolog antikoerper, SH3-domain GRB2-like 1a antikoerper, SH3GL1 antikoerper, Sh3gl1 antikoerper, sh3gl1b antikoerper, sh3gl1.L antikoerper, sh3gl1 antikoerper, sh3gl1a antikoerper

Hintergrund: SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Molekulargewicht: 41 kDa (MW of target protein)