VTA1 Antikörper
-
- Target Alle VTA1 Antikörper anzeigen
- VTA1 (Vps20-Associated 1 Homolog (VTA1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VTA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
- Top Product
- Discover our top product VTA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VTA1 Blocking Peptide, catalog no. 33R-4488, is also available for use as a blocking control in assays to test for specificity of this VTA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VTA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VTA1 (Vps20-Associated 1 Homolog (VTA1))
- Andere Bezeichnung
- VTA1 (VTA1 Produkte)
- Synonyme
- C6orf55 antikoerper, DRG-1 antikoerper, DRG1 antikoerper, LIP5 antikoerper, My012 antikoerper, SBP1 antikoerper, 1110001D18Rik antikoerper, 1110059P08Rik antikoerper, AU040813 antikoerper, C85340 antikoerper, Lip5 antikoerper, RGD1305031 antikoerper, Vps20-associated 1 homolog antikoerper, vesicle trafficking 1 antikoerper, vesicle (multivesicular body) trafficking 1 antikoerper, Vta1 antikoerper, VTA1 antikoerper
- Hintergrund
- C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.
- Molekulargewicht
- 34 kDa (MW of target protein)
-