OSGEP Antikörper (N-Term)

Produktnummer ABIN632411

Produktdetails anti-OSGEP Antikörper

Target: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OSGEP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OSGEP antibody was raised against the N terminal of OSGEP

Aufreinigung: Affinity purified

Immunogen: OSGEP antibody was raised using the N terminal of OSGEP corresponding to a region with amino acids PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSGEP Blocking Peptide, catalog no. 33R-7254, is also available for use as a blocking control in assays to test for specificity of this OSGEP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGEP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OSGEP

Target: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Andere Bezeichnung: OSGEP (OSGEP Produkte)

Hintergrund: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Molekulargewicht: 36 kDa (MW of target protein)