TPPP3 Antikörper (N-Term)

Produktnummer ABIN632414

Produktdetails anti-TPPP3 Antikörper

Target: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPPP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TPPP3 antibody was raised against the N terminal of TPPP3

Aufreinigung: Affinity purified

Immunogen: TPPP3 antibody was raised using the N terminal of TPPP3 corresponding to a region with amino acids MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPPP3 Blocking Peptide, catalog no. 33R-5611, is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPPP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPPP3

Target: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Andere Bezeichnung: TPPP3 (TPPP3 Produkte)

Synonyme: p20 antikoerper, p25gamma antikoerper, 2700055K07Rik antikoerper, CGI-38 antikoerper, Ceacam9 antikoerper, mmCGM8 antikoerper, RGD1305061 antikoerper, tubulin polymerization promoting protein family member 3 antikoerper, tubulin polymerization-promoting protein family member 3 antikoerper, tubulin polymerization-promoting protein family member 3 L homeolog antikoerper, TPPP3 antikoerper, Tppp3 antikoerper, tppp3.L antikoerper

Hintergrund: TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.

Molekulargewicht: 19 kDa (MW of target protein)