C1orf116 Antikörper (Middle Region)

Produktnummer ABIN632417

Produktdetails anti-C1orf116 Antikörper

Target: C1orf116 (c1orf116) (Chromosome 1 Open Reading Frame 116 (c1orf116))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf116 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF116 antibody was raised against the middle region of C1 rf116

Aufreinigung: Affinity purified

Immunogen: C1 ORF116 antibody was raised using the middle region of C1 rf116 corresponding to a region with amino acids SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF116 Blocking Peptide, catalog no. 33R-8474, is also available for use as a blocking control in assays to test for specificity of this C1ORF116 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF116 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf116

Target: C1orf116 (c1orf116) (Chromosome 1 Open Reading Frame 116 (c1orf116))

Andere Bezeichnung: C1ORF116 (c1orf116 Produkte)

Synonyme: SARG antikoerper, C26H1orf116 antikoerper, E030025M07 antikoerper, Sarg antikoerper, chromosome 1 open reading frame 116 antikoerper, chromosome 16 open reading frame, human C1orf116 antikoerper, chromosome 26 C1orf116 homolog antikoerper, expressed sequence AA986860 antikoerper, similar to specifically androgen-regulated protein antikoerper, c1orf116 antikoerper, C1orf116 antikoerper, C16H1orf116 antikoerper, C26H1orf116 antikoerper, AA986860 antikoerper, LOC498222 antikoerper

Hintergrund: C1orf116 belongs to the SARG family. It is a putative androgen-specific receptor. It is highly expressed in prostate.

Molekulargewicht: 37 kDa (MW of target protein)