SH3BGRL Antikörper (Middle Region)

Produktnummer ABIN632421

Produktdetails anti-SH3BGRL Antikörper

Target: SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3BGRL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SH3 BGRL antibody was raised against the middle region of SH3 GRL

Aufreinigung: Affinity purified

Immunogen: SH3 BGRL antibody was raised using the middle region of SH3 GRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3BGRL Blocking Peptide, catalog no. 33R-7300, is also available for use as a blocking control in assays to test for specificity of this SH3BGRL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GRL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3BGRL

Target: SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))

Andere Bezeichnung: SH3BGRL (SH3BGRL Produkte)

Synonyme: sh3bgr antikoerper, SH3BGR antikoerper, 1190008F14Rik antikoerper, SH3BGRL antikoerper, RGD1560520 antikoerper, SH3 domain binding glutamate-rich protein like L homeolog antikoerper, SH3 domain binding glutamate rich protein like antikoerper, SH3-binding domain glutamic acid-rich protein like antikoerper, SH3 domain binding glutamate-rich protein like antikoerper, SH3 domain binding glutamic acid-rich protein like antikoerper, sh3bgrl.L antikoerper, SH3BGRL antikoerper, Sh3bgrl antikoerper, sh3bgrl antikoerper

Hintergrund: SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.

Molekulargewicht: 13 kDa (MW of target protein)