RD3 Antikörper (N-Term)

Produktnummer ABIN632425

Produktdetails anti-RD3 Antikörper

Target: RD3 (Retinal Degeneration 3 (RD3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RD3 antibody was raised against the N terminal of RD3

Aufreinigung: Affinity purified

Immunogen: RD3 antibody was raised using the N terminal of RD3 corresponding to a region with amino acids GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RD3 Blocking Peptide, catalog no. 33R-3503, is also available for use as a blocking control in assays to test for specificity of this RD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RD3

Target: RD3 (Retinal Degeneration 3 (RD3))

Andere Bezeichnung: RD3 (RD3 Produkte)

Synonyme: C1orf36 antikoerper, LCA12 antikoerper, 3322402L07Rik antikoerper, rd-3 antikoerper, rd3 antikoerper, retinal degeneration 3 antikoerper, RD3 antikoerper, Rd3 antikoerper

Hintergrund: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Molekulargewicht: 23 kDa (MW of target protein)