GLRX5 Antikörper (Middle Region)

Produktnummer ABIN632427

Produktdetails anti-GLRX5 Antikörper

Target: GLRX5 (Glutaredoxin 5 (GLRX5))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLRX5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLRX5 antibody was raised against the middle region of GLRX5

Aufreinigung: Affinity purified

Immunogen: GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLRX5 Blocking Peptide, catalog no. 33R-6648, is also available for use as a blocking control in assays to test for specificity of this GLRX5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLRX5

Target: GLRX5 (Glutaredoxin 5 (GLRX5))

Andere Bezeichnung: GLRX5 (GLRX5 Produkte)

Synonyme: grx5 antikoerper, C14orf87 antikoerper, FLB4739 antikoerper, GRX5 antikoerper, PR01238 antikoerper, PRO1238 antikoerper, RGD1308383 antikoerper, 2310004O13Rik antikoerper, 2900070E19Rik antikoerper, AU020725 antikoerper, id:ibd5119 antikoerper, wu:fa09g08 antikoerper, zgc:73343 antikoerper, glutaredoxin 5 L homeolog antikoerper, glutaredoxin 5 antikoerper, glutaredoxin 5 homolog (S. cerevisiae) antikoerper, glrx5.L antikoerper, GLRX5 antikoerper, Glrx5 antikoerper, glrx5 antikoerper

Hintergrund: Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis