QRSL1 Antikörper
-
- Target Alle QRSL1 Antikörper anzeigen
- QRSL1 (Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser QRSL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGRA
- Top Product
- Discover our top product QRSL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
QRSL1 Blocking Peptide, catalog no. 33R-2405, is also available for use as a blocking control in assays to test for specificity of this QRSL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QRSL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- QRSL1 (Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1))
- Andere Bezeichnung
- QRSL1 (QRSL1 Produkte)
- Synonyme
- 0929/02 antikoerper, CG6007 antikoerper, Dmel\\CG6007 antikoerper, bene antikoerper, benedict antikoerper, l(3)S092902 antikoerper, wu:fi03b10 antikoerper, GatA antikoerper, 2700038P16Rik antikoerper, C80053 antikoerper, Glutamyl-tRNA amidotransferase, subunit A antikoerper, glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 antikoerper, glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 L homeolog antikoerper, GatA antikoerper, qrsl1 antikoerper, qrsl1.L antikoerper, QRSL1 antikoerper, Qrsl1 antikoerper
- Hintergrund
- The function of the QRSL1 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 57 kDa (MW of target protein)
-