LRP2BP Antikörper (Middle Region)

Produktnummer ABIN632431

Produktdetails anti-LRP2BP Antikörper

Target: LRP2BP (LRP2 Binding Protein (LRP2BP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRP2BP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRP2 BP antibody was raised against the middle region of LRP2 P

Aufreinigung: Affinity purified

Immunogen: LRP2 BP antibody was raised using the middle region of LRP2 P corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRP2BP Blocking Peptide, catalog no. 33R-8200, is also available for use as a blocking control in assays to test for specificity of this LRP2BP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRP2BP

Target: LRP2BP (LRP2 Binding Protein (LRP2BP))

Andere Bezeichnung: LRP2BP (LRP2BP Produkte)

Synonyme: 1700113N17Rik antikoerper, 2310006J04Rik antikoerper, 4930479L12Rik antikoerper, MegBP antikoerper, RGD1305896 antikoerper, LRP2BP antikoerper, zgc:165631 antikoerper, LRP2 binding protein antikoerper, Lrp2 binding protein antikoerper, LRP2 binding protein S homeolog antikoerper, LRP2BP antikoerper, Lrp2bp antikoerper, lrp2bp antikoerper, lrp2bp.S antikoerper

Hintergrund: LRP2BP may act as an adapter that regulates LRP2 function.

Molekulargewicht: 38 kDa (MW of target protein)