COBLL1 Antikörper (N-Term)
-
- Target Alle COBLL1 Produkte
- COBLL1 (COBL-Like 1 (COBLL1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COBLL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Cobl-Like 1 antibody was raised against the N terminal of COBLL1
- Aufreinigung
- Affinity purified
- Immunogen
- Cobl-Like 1 antibody was raised using the N terminal of COBLL1 corresponding to a region with amino acids SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cobl-Like 1 Blocking Peptide, catalog no. 33R-8308, is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COBLL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COBLL1 (COBL-Like 1 (COBLL1))
- Andere Bezeichnung
- Cobl-Like 1 (COBLL1 Produkte)
- Synonyme
- DKFZp468N1516 antikoerper, 1810047P18Rik antikoerper, Coblr1 antikoerper, D430044D16Rik antikoerper, COBLR1 antikoerper, cordon-bleu WH2 repeat protein like 1 antikoerper, cordon-bleu protein-like 1 antikoerper, Cobl-like 1 antikoerper, cordon-bleu WH2 repeat protein-like 1 antikoerper, COBLL1 antikoerper, LOC100546808 antikoerper, Cobll1 antikoerper
- Hintergrund
- The function of this gene remains unknown.
- Molekulargewicht
- 128 kDa (MW of target protein)
-